Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843
  1. Avatar for malik_x 141. malik_x Lv 1 1 pt. 5,843
  2. Avatar for bkoep 142. bkoep Lv 1 1 pt. 5,843
  3. Avatar for equilibria 143. equilibria Lv 1 1 pt. 5,843
  4. Avatar for Clement Wong 144. Clement Wong Lv 1 1 pt. 5,843
  5. Avatar for cinnik 145. cinnik Lv 1 1 pt. 5,843
  6. Avatar for Jdoucette019 146. Jdoucette019 Lv 1 1 pt. 5,843
  7. Avatar for 808Applesauce 147. 808Applesauce Lv 1 1 pt. 5,843
  8. Avatar for sakshamphul 148. sakshamphul Lv 1 1 pt. 5,843

Comments