Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843
  1. Avatar for newmra2022 141. newmra2022 Lv 1 1 pt. 5,843
  2. Avatar for Stephanie Y_X401 142. Stephanie Y_X401 Lv 1 1 pt. 5,843
  3. Avatar for anirudha_t 143. anirudha_t Lv 1 1 pt. 5,843
  4. Avatar for sherlomck_7 144. sherlomck_7 Lv 1 1 pt. 5,843
  5. Avatar for cheny495 145. cheny495 Lv 1 1 pt. 5,843
  6. Avatar for r-blaze 146. r-blaze Lv 1 1 pt. 5,843
  7. Avatar for ihr 147. ihr Lv 1 1 pt. 5,843
  8. Avatar for sakshamphul 148. sakshamphul Lv 1 1 pt. 5,843

Comments