Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843

  1. Avatar for robgee 11. robgee Lv 1 71 pts. 10,991
  2. Avatar for fpc 12. fpc Lv 1 68 pts. 10,979
  3. Avatar for Aubade01 13. Aubade01 Lv 1 66 pts. 10,977
  4. Avatar for jobo0502 14. jobo0502 Lv 1 63 pts. 10,961
  5. Avatar for RockOn 15. RockOn Lv 1 61 pts. 10,955
  6. Avatar for guineapig 16. guineapig Lv 1 59 pts. 10,936
  7. Avatar for Blipperman 17. Blipperman Lv 1 57 pts. 10,916
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 55 pts. 10,914
  9. Avatar for frood66 19. frood66 Lv 1 53 pts. 10,908
  10. Avatar for alcor29 20. alcor29 Lv 1 51 pts. 10,907

Comments