Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843

  1. Avatar for Sandrix72 21. Sandrix72 Lv 1 49 pts. 10,903
  2. Avatar for georg137 22. georg137 Lv 1 47 pts. 10,883
  3. Avatar for Bailo 23. Bailo Lv 1 45 pts. 10,879
  4. Avatar for Arthuriel 24. Arthuriel Lv 1 43 pts. 10,878
  5. Avatar for dizzywings 25. dizzywings Lv 1 42 pts. 10,873
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 40 pts. 10,825
  7. Avatar for zippyc137 27. zippyc137 Lv 1 38 pts. 10,815
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 37 pts. 10,813
  9. Avatar for Lotus23 29. Lotus23 Lv 1 35 pts. 10,808
  10. Avatar for jausmh 30. jausmh Lv 1 34 pts. 10,780

Comments