Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843

  1. Avatar for wosser1 61. wosser1 Lv 1 8 pts. 9,959
  2. Avatar for sftgfop1 62. sftgfop1 Lv 1 7 pts. 9,959
  3. Avatar for Larini 63. Larini Lv 1 7 pts. 9,937
  4. Avatar for AlkiP0Ps 64. AlkiP0Ps Lv 1 7 pts. 9,921
  5. Avatar for rezaefar 65. rezaefar Lv 1 6 pts. 9,920
  6. Avatar for Beany 66. Beany Lv 1 6 pts. 9,860
  7. Avatar for MrZanav 67. MrZanav Lv 1 6 pts. 9,850
  8. Avatar for heyubob 68. heyubob Lv 1 5 pts. 9,801
  9. Avatar for Mohoernchen 69. Mohoernchen Lv 1 5 pts. 9,791
  10. Avatar for DScott 70. DScott Lv 1 5 pts. 9,768

Comments