Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843

  1. Avatar for Dr.Sillem 71. Dr.Sillem Lv 1 4 pts. 9,735
  2. Avatar for froschi2 72. froschi2 Lv 1 4 pts. 9,725
  3. Avatar for rinze 73. rinze Lv 1 4 pts. 9,668
  4. Avatar for mart0258 74. mart0258 Lv 1 4 pts. 9,667
  5. Avatar for deondra10 75. deondra10 Lv 1 4 pts. 9,604
  6. Avatar for micromajor98 76. micromajor98 Lv 1 3 pts. 9,603
  7. Avatar for pruneau_44 77. pruneau_44 Lv 1 3 pts. 9,598
  8. Avatar for lawrencem150218 78. lawrencem150218 Lv 1 3 pts. 9,518
  9. Avatar for katling 79. katling Lv 1 3 pts. 9,513
  10. Avatar for whuai 80. whuai Lv 1 3 pts. 9,502

Comments