Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843

  1. Avatar for dboscombe 81. dboscombe Lv 1 2 pts. 9,480
  2. Avatar for silent gene 82. silent gene Lv 1 2 pts. 9,469
  3. Avatar for LELE1964 83. LELE1964 Lv 1 2 pts. 9,465
  4. Avatar for furi0us 84. furi0us Lv 1 2 pts. 9,458
  5. Avatar for jbarnwell 85. jbarnwell Lv 1 2 pts. 9,439
  6. Avatar for Sciren 86. Sciren Lv 1 2 pts. 9,431
  7. Avatar for Deleted player 87. Deleted player pts. 9,417
  8. Avatar for cjddig 88. cjddig Lv 1 2 pts. 9,408
  9. Avatar for hada 89. hada Lv 1 2 pts. 9,387
  10. Avatar for Lab_mouse 90. Lab_mouse Lv 1 1 pt. 9,363

Comments