Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,146
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 11,111
  3. Avatar for Go Science 3. Go Science 41 pts. 11,106
  4. Avatar for Contenders 4. Contenders 24 pts. 11,041
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 10,979
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,961
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 10,916
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,968
  9. Avatar for Australia 9. Australia 1 pt. 9,921
  10. Avatar for Foldit Staff 10. Foldit Staff 1 pt. 9,431
  1. Avatar for fiendish_ghoul 31. fiendish_ghoul Lv 1 32 pts. 10,747
  2. Avatar for SirWill3 32. SirWill3 Lv 1 31 pts. 10,670
  3. Avatar for heather-1 33. heather-1 Lv 1 30 pts. 10,656
  4. Avatar for Visok 34. Visok Lv 1 29 pts. 10,656
  5. Avatar for akaaka 35. akaaka Lv 1 27 pts. 10,655
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 26 pts. 10,599
  7. Avatar for BarrySampson 37. BarrySampson Lv 1 25 pts. 10,593
  8. Avatar for infjamc 38. infjamc Lv 1 24 pts. 10,588
  9. Avatar for NeLikomSheet 39. NeLikomSheet Lv 1 23 pts. 10,573
  10. Avatar for Merf 40. Merf Lv 1 22 pts. 10,556

Comments