Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,780
  2. Avatar for BootsMcGraw 2. BootsMcGraw Lv 1 97 pts. 9,776
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 93 pts. 9,772
  4. Avatar for MicElephant 4. MicElephant Lv 1 90 pts. 9,769
  5. Avatar for Galaxie 5. Galaxie Lv 1 87 pts. 9,768
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 83 pts. 9,768
  7. Avatar for jobo0502 7. jobo0502 Lv 1 80 pts. 9,760
  8. Avatar for robgee 8. robgee Lv 1 77 pts. 9,758
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 74 pts. 9,758
  10. Avatar for g_b 10. g_b Lv 1 71 pts. 9,757

Comments