Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289
  1. Avatar for gmn 11. gmn Lv 1 69 pts. 9,754
  2. Avatar for borattt 12. borattt Lv 1 66 pts. 9,750
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 63 pts. 9,744
  4. Avatar for georg137 14. georg137 Lv 1 61 pts. 9,733
  5. Avatar for Sandrix72 15. Sandrix72 Lv 1 58 pts. 9,733
  6. Avatar for Punzi Baker 2 16. Punzi Baker 2 Lv 1 56 pts. 9,726
  7. Avatar for fpc 17. fpc Lv 1 54 pts. 9,726
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 52 pts. 9,710
  9. Avatar for phi16 19. phi16 Lv 1 49 pts. 9,707
  10. Avatar for bamh 20. bamh Lv 1 47 pts. 9,694

Comments