Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289

  1. Avatar for Skippysk8s 21. Skippysk8s Lv 1 45 pts. 9,692
  2. Avatar for manu8170 22. manu8170 Lv 1 43 pts. 9,691
  3. Avatar for alcor29 23. alcor29 Lv 1 42 pts. 9,668
  4. Avatar for ProfVince 24. ProfVince Lv 1 40 pts. 9,665
  5. Avatar for Blipperman 25. Blipperman Lv 1 38 pts. 9,664
  6. Avatar for guineapig 26. guineapig Lv 1 36 pts. 9,662
  7. Avatar for Bletchley Park 27. Bletchley Park Lv 1 35 pts. 9,657
  8. Avatar for frood66 28. frood66 Lv 1 33 pts. 9,654
  9. Avatar for Bailo 29. Bailo Lv 1 32 pts. 9,652
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 30 pts. 9,643

Comments