Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289
  1. Avatar for zippyc137 41. zippyc137 Lv 1 18 pts. 9,583
  2. Avatar for zackallen 42. zackallen Lv 1 17 pts. 9,580
  3. Avatar for akaaka 43. akaaka Lv 1 16 pts. 9,576
  4. Avatar for Cyberkashi 44. Cyberkashi Lv 1 15 pts. 9,561
  5. Avatar for Vinara 45. Vinara Lv 1 14 pts. 9,554
  6. Avatar for Visok 46. Visok Lv 1 14 pts. 9,549
  7. Avatar for Beany 47. Beany Lv 1 13 pts. 9,543
  8. Avatar for spongiformasquarepantsii 48. spongiformasquarepantsii Lv 1 12 pts. 9,541
  9. Avatar for NPrincipi 49. NPrincipi Lv 1 12 pts. 9,533
  10. Avatar for Trajan464 50. Trajan464 Lv 1 11 pts. 9,482

Comments