Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289
  1. Avatar for abiogenesis 51. abiogenesis Lv 1 10 pts. 9,476
  2. Avatar for AlkiP0Ps 52. AlkiP0Ps Lv 1 10 pts. 9,468
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 9 pts. 9,466
  4. Avatar for heather-1 54. heather-1 Lv 1 9 pts. 9,463
  5. Avatar for kevin everington 55. kevin everington Lv 1 8 pts. 9,448
  6. Avatar for carxo 56. carxo Lv 1 8 pts. 9,437
  7. Avatar for hansvandenhof 57. hansvandenhof Lv 1 7 pts. 9,436
  8. Avatar for Hellcat6 58. Hellcat6 Lv 1 7 pts. 9,403
  9. Avatar for Pexiixep 59. Pexiixep Lv 1 7 pts. 9,376
  10. Avatar for Arthuriel 60. Arthuriel Lv 1 6 pts. 9,366

Comments