Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289
  1. Avatar for DScott 71. DScott Lv 1 3 pts. 9,171
  2. Avatar for chrisb41 72. chrisb41 Lv 1 3 pts. 9,140
  3. Avatar for AlphaFold2 73. AlphaFold2 Lv 1 3 pts. 9,133
  4. Avatar for ethanyang 74. ethanyang Lv 1 3 pts. 9,118
  5. Avatar for katling 75. katling Lv 1 2 pts. 9,106
  6. Avatar for Simek 76. Simek Lv 1 2 pts. 9,069
  7. Avatar for Mohoernchen 77. Mohoernchen Lv 1 2 pts. 9,041
  8. Avatar for froschi2 78. froschi2 Lv 1 2 pts. 9,037
  9. Avatar for diamonddays 79. diamonddays Lv 1 2 pts. 8,999
  10. Avatar for can1492 80. can1492 Lv 1 2 pts. 8,996

Comments