Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,780
  2. Avatar for Contenders 2. Contenders 73 pts. 9,777
  3. Avatar for Go Science 3. Go Science 52 pts. 9,772
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,768
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,760
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,726
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,692
  8. Avatar for ProWigglers-AKLab 8. ProWigglers-AKLab 6 pts. 9,541
  9. Avatar for Australia 9. Australia 4 pts. 9,468
  10. Avatar for Ogre's lab 10. Ogre's lab 2 pts. 9,279
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,778
  2. Avatar for maithra 2. maithra Lv 1 63 pts. 9,777
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 37 pts. 9,767
  4. Avatar for MicElephant 4. MicElephant Lv 1 21 pts. 9,765
  5. Avatar for guineapig 5. guineapig Lv 1 11 pts. 9,763
  6. Avatar for Galaxie 6. Galaxie Lv 1 5 pts. 9,763
  7. Avatar for phi16 7. phi16 Lv 1 2 pts. 9,741
  8. Avatar for gmn 8. gmn Lv 1 1 pt. 9,728
  9. Avatar for robgee 9. robgee Lv 1 1 pt. 9,726
  10. Avatar for alcor29 10. alcor29 Lv 1 1 pt. 9,723

Comments