Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,780
  2. Avatar for Contenders 2. Contenders 73 pts. 9,777
  3. Avatar for Go Science 3. Go Science 52 pts. 9,772
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,768
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,760
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,726
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,692
  8. Avatar for ProWigglers-AKLab 8. ProWigglers-AKLab 6 pts. 9,541
  9. Avatar for Australia 9. Australia 4 pts. 9,468
  10. Avatar for Ogre's lab 10. Ogre's lab 2 pts. 9,279

  1. Avatar for gmn 11. gmn Lv 1 69 pts. 9,754
  2. Avatar for borattt 12. borattt Lv 1 66 pts. 9,750
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 63 pts. 9,744
  4. Avatar for georg137 14. georg137 Lv 1 61 pts. 9,733
  5. Avatar for Sandrix72 15. Sandrix72 Lv 1 58 pts. 9,733
  6. Avatar for Punzi Baker 2 16. Punzi Baker 2 Lv 1 56 pts. 9,726
  7. Avatar for fpc 17. fpc Lv 1 54 pts. 9,726
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 52 pts. 9,710
  9. Avatar for phi16 19. phi16 Lv 1 49 pts. 9,707
  10. Avatar for bamh 20. bamh Lv 1 47 pts. 9,694

Comments