Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,780
  2. Avatar for Contenders 2. Contenders 73 pts. 9,777
  3. Avatar for Go Science 3. Go Science 52 pts. 9,772
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,768
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,760
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,726
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,692
  8. Avatar for ProWigglers-AKLab 8. ProWigglers-AKLab 6 pts. 9,541
  9. Avatar for Australia 9. Australia 4 pts. 9,468
  10. Avatar for Ogre's lab 10. Ogre's lab 2 pts. 9,279

  1. Avatar for Merf 61. Merf Lv 1 6 pts. 9,357
  2. Avatar for MythicalPingu 62. MythicalPingu Lv 1 5 pts. 9,333
  3. Avatar for rezaefar 63. rezaefar Lv 1 5 pts. 9,315
  4. Avatar for Borets 65. Borets Lv 1 5 pts. 9,279
  5. Avatar for jsfoldingaccount 66. jsfoldingaccount Lv 1 4 pts. 9,268
  6. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 4 pts. 9,264
  7. Avatar for tracybutt 68. tracybutt Lv 1 4 pts. 9,219
  8. Avatar for Larini 69. Larini Lv 1 4 pts. 9,203
  9. Avatar for antibot215 70. antibot215 Lv 1 3 pts. 9,179

Comments