Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,780
  2. Avatar for Contenders 2. Contenders 73 pts. 9,777
  3. Avatar for Go Science 3. Go Science 52 pts. 9,772
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,768
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,760
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,726
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,692
  8. Avatar for ProWigglers-AKLab 8. ProWigglers-AKLab 6 pts. 9,541
  9. Avatar for Australia 9. Australia 4 pts. 9,468
  10. Avatar for Ogre's lab 10. Ogre's lab 2 pts. 9,279
  1. Avatar for Lotus23 31. Lotus23 Lv 1 29 pts. 9,643
  2. Avatar for Oransche 32. Oransche Lv 1 28 pts. 9,640
  3. Avatar for maithra 33. maithra Lv 1 26 pts. 9,640
  4. Avatar for BarrySampson 34. BarrySampson Lv 1 25 pts. 9,620
  5. Avatar for equilibria 35. equilibria Lv 1 24 pts. 9,617
  6. Avatar for kyoota 36. kyoota Lv 1 23 pts. 9,606
  7. Avatar for PeterDav 37. PeterDav Lv 1 22 pts. 9,592
  8. Avatar for NeLikomSheet 38. NeLikomSheet Lv 1 21 pts. 9,587
  9. Avatar for fiendish_ghoul 39. fiendish_ghoul Lv 1 20 pts. 9,586
  10. Avatar for infjamc 40. infjamc Lv 1 19 pts. 9,585

Comments