Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since almost 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 19,041
  2. Avatar for Australia 12. Australia 1 pt. 18,921
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 18,875
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 18,408
  5. Avatar for G1051331 15. G1051331 1 pt. 18,361
  6. Avatar for Team China 16. Team China 1 pt. 18,038
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,213
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 19,411
  2. Avatar for MicElephant 2. MicElephant Lv 1 68 pts. 19,383
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 44 pts. 19,381
  4. Avatar for Galaxie 4. Galaxie Lv 1 27 pts. 19,371
  5. Avatar for guineapig 5. guineapig Lv 1 16 pts. 19,366
  6. Avatar for gmn 6. gmn Lv 1 9 pts. 19,339
  7. Avatar for maithra 7. maithra Lv 1 5 pts. 19,337
  8. Avatar for alcor29 8. alcor29 Lv 1 3 pts. 19,336
  9. Avatar for kyoota 9. kyoota Lv 1 1 pt. 19,335
  10. Avatar for robgee 10. robgee Lv 1 1 pt. 19,330

Comments

LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.