Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since almost 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 19,041
  2. Avatar for Australia 12. Australia 1 pt. 18,921
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 18,875
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 18,408
  5. Avatar for G1051331 15. G1051331 1 pt. 18,361
  6. Avatar for Team China 16. Team China 1 pt. 18,038
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,213
  1. Avatar for Sandrix72 11. Sandrix72 Lv 1 54 pts. 19,309
  2. Avatar for jausmh 12. jausmh Lv 1 51 pts. 19,305
  3. Avatar for grogar7 13. grogar7 Lv 1 48 pts. 19,304
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 45 pts. 19,304
  5. Avatar for blazegeek 15. blazegeek Lv 1 42 pts. 19,302
  6. Avatar for Cyberkashi 16. Cyberkashi Lv 1 39 pts. 19,301
  7. Avatar for robgee 17. robgee Lv 1 36 pts. 19,300
  8. Avatar for zippyc137 18. zippyc137 Lv 1 34 pts. 19,300
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 31 pts. 19,275
  10. Avatar for alcor29 20. alcor29 Lv 1 29 pts. 19,274

Comments

LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.