Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 19,041
  2. Avatar for Australia 12. Australia 1 pt. 18,921
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 18,875
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 18,408
  5. Avatar for G1051331 15. G1051331 1 pt. 18,361
  6. Avatar for Team China 16. Team China 1 pt. 18,038
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,213
  1. Avatar for jamiexq 41. jamiexq Lv 1 5 pts. 18,990
  2. Avatar for equilibria 42. equilibria Lv 1 4 pts. 18,962
  3. Avatar for Merf 43. Merf Lv 1 4 pts. 18,927
  4. Avatar for AlkiP0Ps 44. AlkiP0Ps Lv 1 4 pts. 18,921
  5. Avatar for Oransche 45. Oransche Lv 1 3 pts. 18,910
  6. Avatar for infjamc 46. infjamc Lv 1 3 pts. 18,900
  7. Avatar for Borets 47. Borets Lv 1 3 pts. 18,875
  8. Avatar for frostschutz 48. frostschutz Lv 1 2 pts. 18,824
  9. Avatar for BarrySampson 49. BarrySampson Lv 1 2 pts. 18,819
  10. Avatar for Trajan464 50. Trajan464 Lv 1 2 pts. 18,810

Comments

LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.