Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 19,041
  2. Avatar for Australia 12. Australia 1 pt. 18,921
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 18,875
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 18,408
  5. Avatar for G1051331 15. G1051331 1 pt. 18,361
  6. Avatar for Team China 16. Team China 1 pt. 18,038
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,213
  1. Avatar for Zosa 61. Zosa Lv 1 1 pt. 18,488
  2. Avatar for antibot215 62. antibot215 Lv 1 1 pt. 18,477
  3. Avatar for Larini 63. Larini Lv 1 1 pt. 18,471
  4. Avatar for furi0us 64. furi0us Lv 1 1 pt. 18,462
  5. Avatar for DScott 65. DScott Lv 1 1 pt. 18,456
  6. Avatar for Sammy3c2b1a0 66. Sammy3c2b1a0 Lv 1 1 pt. 18,408
  7. Avatar for dizzywings 67. dizzywings Lv 1 1 pt. 18,385
  8. Avatar for Arne Heessels 68. Arne Heessels Lv 1 1 pt. 18,379
  9. Avatar for carxo 69. carxo Lv 1 1 pt. 18,372
  10. Avatar for abiogenesis 70. abiogenesis Lv 1 1 pt. 18,364

Comments

LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.