Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 19,041
  2. Avatar for Australia 12. Australia 1 pt. 18,921
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 18,875
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 18,408
  5. Avatar for G1051331 15. G1051331 1 pt. 18,361
  6. Avatar for Team China 16. Team China 1 pt. 18,038
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,213
  1. Avatar for pin.pab.2001 71. pin.pab.2001 Lv 1 1 pt. 18,361
  2. Avatar for spvincent 72. spvincent Lv 1 1 pt. 18,321
  3. Avatar for Hellcat6 73. Hellcat6 Lv 1 1 pt. 18,302
  4. Avatar for Swapper242 74. Swapper242 Lv 1 1 pt. 18,282
  5. Avatar for Mohoernchen 75. Mohoernchen Lv 1 1 pt. 18,223
  6. Avatar for Hebrew Hitman 76. Hebrew Hitman Lv 1 1 pt. 18,206
  7. Avatar for tracybutt 77. tracybutt Lv 1 1 pt. 18,192
  8. Avatar for zo3xiaJonWeinberg 78. zo3xiaJonWeinberg Lv 1 1 pt. 18,038
  9. Avatar for Susume 79. Susume Lv 1 1 pt. 17,748
  10. Avatar for DD_214 80. DD_214 Lv 1 1 pt. 9,570

Comments

LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.