Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 19,041
  2. Avatar for Australia 12. Australia 1 pt. 18,921
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 18,875
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 18,408
  5. Avatar for G1051331 15. G1051331 1 pt. 18,361
  6. Avatar for Team China 16. Team China 1 pt. 18,038
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,213
  1. Avatar for tt_yao 81. tt_yao Lv 1 1 pt. 5,213
  2. Avatar for jsfoldingaccount 82. jsfoldingaccount Lv 1 1 pt. 5,213
  3. Avatar for joshmiller 83. joshmiller Lv 1 1 pt. 5,213
  4. Avatar for Prion_research 84. Prion_research Lv 1 1 pt. 5,213
  5. Avatar for aka_bkoep 85. aka_bkoep Lv 1 1 pt. 5,213
  6. Avatar for bkoep 86. bkoep Lv 1 1 pt. 5,213
  7. Avatar for rmoretti 87. rmoretti Lv 1 1 pt. 5,213

Comments

LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.