Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 19,413
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 19,413
  3. Avatar for Go Science 3. Go Science 52 pts. 19,385
  4. Avatar for Contenders 4. Contenders 36 pts. 19,385
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 19,305
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 19,261
  7. Avatar for VeFold 7. VeFold 10 pts. 19,174
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 6 pts. 19,141
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 19,141
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 19,070

  1. Avatar for Sandrix72 11. Sandrix72 Lv 1 54 pts. 19,309
  2. Avatar for jausmh 12. jausmh Lv 1 51 pts. 19,305
  3. Avatar for grogar7 13. grogar7 Lv 1 48 pts. 19,304
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 45 pts. 19,304
  5. Avatar for blazegeek 15. blazegeek Lv 1 42 pts. 19,302
  6. Avatar for Cyberkashi 16. Cyberkashi Lv 1 39 pts. 19,301
  7. Avatar for robgee 17. robgee Lv 1 36 pts. 19,300
  8. Avatar for zippyc137 18. zippyc137 Lv 1 34 pts. 19,300
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 31 pts. 19,275
  10. Avatar for alcor29 20. alcor29 Lv 1 29 pts. 19,274

Comments


LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.