Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since about 4 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 19,413
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 19,413
  3. Avatar for Go Science 3. Go Science 52 pts. 19,385
  4. Avatar for Contenders 4. Contenders 36 pts. 19,385
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 19,305
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 19,261
  7. Avatar for VeFold 7. VeFold 10 pts. 19,174
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 6 pts. 19,141
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 19,141
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 19,070

  1. Avatar for pin.pab.2001 71. pin.pab.2001 Lv 1 1 pt. 18,361
  2. Avatar for spvincent 72. spvincent Lv 1 1 pt. 18,321
  3. Avatar for Hellcat6 73. Hellcat6 Lv 1 1 pt. 18,302
  4. Avatar for Swapper242 74. Swapper242 Lv 1 1 pt. 18,282
  5. Avatar for Mohoernchen 75. Mohoernchen Lv 1 1 pt. 18,223
  6. Avatar for Hebrew Hitman 76. Hebrew Hitman Lv 1 1 pt. 18,206
  7. Avatar for tracybutt 77. tracybutt Lv 1 1 pt. 18,192
  8. Avatar for zo3xiaJonWeinberg 78. zo3xiaJonWeinberg Lv 1 1 pt. 18,038
  9. Avatar for Susume 79. Susume Lv 1 1 pt. 17,748
  10. Avatar for DD_214 80. DD_214 Lv 1 1 pt. 9,570

Comments


LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.