Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,309
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,103
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,580
  4. Avatar for BioCentric 14. BioCentric 1 pt. 8,161
  5. Avatar for Team China 15. Team China 1 pt. 7,916
  6. Avatar for OmHS 16. OmHS 1 pt. 7,720
  7. Avatar for SHELL 17. SHELL 1 pt. 7,646
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,900
  9. Avatar for test_group1 19. test_group1 1 pt. 0

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,877
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 97 pts. 10,777
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 94 pts. 10,715
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 90 pts. 10,682
  5. Avatar for Sandrix72 5. Sandrix72 Lv 1 87 pts. 10,628
  6. Avatar for NPrincipi 6. NPrincipi Lv 1 84 pts. 10,612
  7. Avatar for georg137 7. georg137 Lv 1 81 pts. 10,605
  8. Avatar for grogar7 8. grogar7 Lv 1 78 pts. 10,599
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 75 pts. 10,598
  10. Avatar for g_b 10. g_b Lv 1 72 pts. 10,541

Comments