Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,309
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,103
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,580
  4. Avatar for BioCentric 14. BioCentric 1 pt. 8,161
  5. Avatar for Team China 15. Team China 1 pt. 7,916
  6. Avatar for OmHS 16. OmHS 1 pt. 7,720
  7. Avatar for SHELL 17. SHELL 1 pt. 7,646
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,900
  9. Avatar for test_group1 19. test_group1 1 pt. 0
  1. Avatar for treyher 101. treyher Lv 1 1 pt. 8,161
  2. Avatar for Tamera 102. Tamera Lv 1 1 pt. 8,077
  3. Avatar for TheYellowKnight 103. TheYellowKnight Lv 1 1 pt. 8,068
  4. Avatar for TravisA18 104. TravisA18 Lv 1 1 pt. 8,050
  5. Avatar for GiletJaune 105. GiletJaune Lv 1 1 pt. 8,036
  6. Avatar for furi0us 106. furi0us Lv 1 1 pt. 8,017
  7. Avatar for pharmpholder 107. pharmpholder Lv 1 1 pt. 7,932
  8. Avatar for Deleted player 108. Deleted player 1 pt. 7,919
  9. Avatar for zo3xiaJonWeinberg 109. zo3xiaJonWeinberg Lv 1 1 pt. 7,916
  10. Avatar for Sammy3c2b1a0 110. Sammy3c2b1a0 Lv 1 1 pt. 7,893

Comments