Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,309
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,103
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,580
  4. Avatar for BioCentric 14. BioCentric 1 pt. 8,161
  5. Avatar for Team China 15. Team China 1 pt. 7,916
  6. Avatar for OmHS 16. OmHS 1 pt. 7,720
  7. Avatar for SHELL 17. SHELL 1 pt. 7,646
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,900
  9. Avatar for test_group1 19. test_group1 1 pt. 0
  1. Avatar for Hebrew Hitman 111. Hebrew Hitman Lv 1 1 pt. 7,891
  2. Avatar for Katelynsb 112. Katelynsb Lv 1 1 pt. 7,808
  3. Avatar for kludbrook 113. kludbrook Lv 1 1 pt. 7,806
  4. Avatar for Einklee 114. Einklee Lv 1 1 pt. 7,790
  5. Avatar for lhuang20 115. lhuang20 Lv 1 1 pt. 7,788
  6. Avatar for davidandersoniii 116. davidandersoniii Lv 1 1 pt. 7,775
  7. Avatar for lbbusby 117. lbbusby Lv 1 1 pt. 7,763
  8. Avatar for touchsomegrass 118. touchsomegrass Lv 1 1 pt. 7,720
  9. Avatar for sentientpangolin 119. sentientpangolin Lv 1 1 pt. 7,701
  10. Avatar for U202142626 120. U202142626 Lv 1 1 pt. 7,646

Comments