Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,309
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,103
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,580
  4. Avatar for BioCentric 14. BioCentric 1 pt. 8,161
  5. Avatar for Team China 15. Team China 1 pt. 7,916
  6. Avatar for OmHS 16. OmHS 1 pt. 7,720
  7. Avatar for SHELL 17. SHELL 1 pt. 7,646
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,900
  9. Avatar for test_group1 19. test_group1 1 pt. 0

  1. Avatar for jobo0502 11. jobo0502 Lv 1 70 pts. 10,489
  2. Avatar for Galaxie 12. Galaxie Lv 1 67 pts. 10,486
  3. Avatar for gmn 13. gmn Lv 1 64 pts. 10,486
  4. Avatar for guineapig 14. guineapig Lv 1 62 pts. 10,425
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 60 pts. 10,412
  6. Avatar for jausmh 16. jausmh Lv 1 57 pts. 10,381
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 55 pts. 10,344
  8. Avatar for RockOn 18. RockOn Lv 1 53 pts. 10,342
  9. Avatar for MicElephant 19. MicElephant Lv 1 51 pts. 10,339
  10. Avatar for frood66 20. frood66 Lv 1 49 pts. 10,330

Comments