Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,309
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,103
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,580
  4. Avatar for BioCentric 14. BioCentric 1 pt. 8,161
  5. Avatar for Team China 15. Team China 1 pt. 7,916
  6. Avatar for OmHS 16. OmHS 1 pt. 7,720
  7. Avatar for SHELL 17. SHELL 1 pt. 7,646
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,900
  9. Avatar for test_group1 19. test_group1 1 pt. 0
  1. Avatar for maithra 41. maithra Lv 1 19 pts. 9,794
  2. Avatar for ucad 42. ucad Lv 1 18 pts. 9,763
  3. Avatar for PeterDav 43. PeterDav Lv 1 17 pts. 9,738
  4. Avatar for phi16 44. phi16 Lv 1 16 pts. 9,733
  5. Avatar for heather-1 45. heather-1 Lv 1 16 pts. 9,705
  6. Avatar for ProfVince 46. ProfVince Lv 1 15 pts. 9,689
  7. Avatar for carxo 47. carxo Lv 1 14 pts. 9,642
  8. Avatar for Deleted player 48. Deleted player 13 pts. 9,596
  9. Avatar for Visok 49. Visok Lv 1 13 pts. 9,574
  10. Avatar for kevin everington 50. kevin everington Lv 1 12 pts. 9,531

Comments