Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,309
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,103
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,580
  4. Avatar for BioCentric 14. BioCentric 1 pt. 8,161
  5. Avatar for Team China 15. Team China 1 pt. 7,916
  6. Avatar for OmHS 16. OmHS 1 pt. 7,720
  7. Avatar for SHELL 17. SHELL 1 pt. 7,646
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,900
  9. Avatar for test_group1 19. test_group1 1 pt. 0
  1. Avatar for Savas 71. Savas Lv 1 4 pts. 9,103
  2. Avatar for Dr.Sillem 72. Dr.Sillem Lv 1 3 pts. 9,077
  3. Avatar for kitsoune 73. kitsoune Lv 1 3 pts. 8,996
  4. Avatar for Trajan464 74. Trajan464 Lv 1 3 pts. 8,974
  5. Avatar for dkpotter 75. dkpotter Lv 1 3 pts. 8,968
  6. Avatar for mnplank 76. mnplank Lv 1 3 pts. 8,873
  7. Avatar for fiendish_ghoul 77. fiendish_ghoul Lv 1 2 pts. 8,871
  8. Avatar for Larini 78. Larini Lv 1 2 pts. 8,866
  9. Avatar for Beany 79. Beany Lv 1 2 pts. 8,838
  10. Avatar for froschi2 80. froschi2 Lv 1 2 pts. 8,832

Comments