Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,309
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,103
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,580
  4. Avatar for BioCentric 14. BioCentric 1 pt. 8,161
  5. Avatar for Team China 15. Team China 1 pt. 7,916
  6. Avatar for OmHS 16. OmHS 1 pt. 7,720
  7. Avatar for SHELL 17. SHELL 1 pt. 7,646
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,900
  9. Avatar for test_group1 19. test_group1 1 pt. 0
  1. Avatar for Keresto 81. Keresto Lv 1 2 pts. 8,780
  2. Avatar for DScott 82. DScott Lv 1 2 pts. 8,778
  3. Avatar for jsfoldingaccount 83. jsfoldingaccount Lv 1 2 pts. 8,747
  4. Avatar for rinze 84. rinze Lv 1 2 pts. 8,740
  5. Avatar for aowens4 85. aowens4 Lv 1 2 pts. 8,725
  6. Avatar for tracybutt 86. tracybutt Lv 1 1 pt. 8,713
  7. Avatar for EpicSmashMan 87. EpicSmashMan Lv 1 1 pt. 8,709
  8. Avatar for blaine.fiss 88. blaine.fiss Lv 1 1 pt. 8,708
  9. Avatar for knhunt1 89. knhunt1 Lv 1 1 pt. 8,685
  10. Avatar for Arne Heessels 90. Arne Heessels Lv 1 1 pt. 8,650

Comments