Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,877
  2. Avatar for Contenders 2. Contenders 76 pts. 10,777
  3. Avatar for Go Science 3. Go Science 56 pts. 10,720
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,489
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,455
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 10,130
  7. Avatar for AlphaFold 7. AlphaFold 14 pts. 9,872
  8. Avatar for Beta Folders 8. Beta Folders 9 pts. 9,777
  9. Avatar for Coastal Biochemistry 9. Coastal Biochemistry 6 pts. 9,418
  10. Avatar for Australia 10. Australia 4 pts. 9,371

  1. Avatar for Savas 71. Savas Lv 1 4 pts. 9,103
  2. Avatar for Dr.Sillem 72. Dr.Sillem Lv 1 3 pts. 9,077
  3. Avatar for kitsoune 73. kitsoune Lv 1 3 pts. 8,996
  4. Avatar for Trajan464 74. Trajan464 Lv 1 3 pts. 8,974
  5. Avatar for dkpotter 75. dkpotter Lv 1 3 pts. 8,968
  6. Avatar for mnplank 76. mnplank Lv 1 3 pts. 8,873
  7. Avatar for fiendish_ghoul 77. fiendish_ghoul Lv 1 2 pts. 8,871
  8. Avatar for Larini 78. Larini Lv 1 2 pts. 8,866
  9. Avatar for Beany 79. Beany Lv 1 2 pts. 8,838
  10. Avatar for froschi2 80. froschi2 Lv 1 2 pts. 8,832

Comments