Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,877
  2. Avatar for Contenders 2. Contenders 76 pts. 10,777
  3. Avatar for Go Science 3. Go Science 56 pts. 10,720
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,489
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,455
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 10,130
  7. Avatar for AlphaFold 7. AlphaFold 14 pts. 9,872
  8. Avatar for Beta Folders 8. Beta Folders 9 pts. 9,777
  9. Avatar for Coastal Biochemistry 9. Coastal Biochemistry 6 pts. 9,418
  10. Avatar for Australia 10. Australia 4 pts. 9,371
  1. Avatar for scottwuzhear 121. scottwuzhear Lv 1 1 pt. 7,609
  2. Avatar for userbook 122. userbook Lv 1 1 pt. 7,595
  3. Avatar for Jeogyeok 123. Jeogyeok Lv 1 1 pt. 7,526
  4. Avatar for TokyoTF 124. TokyoTF Lv 1 1 pt. 7,497
  5. Avatar for moflanagan 125. moflanagan Lv 1 1 pt. 7,317
  6. Avatar for hada 126. hada Lv 1 1 pt. 6,873
  7. Avatar for rene4833 127. rene4833 Lv 1 1 pt. 6,641
  8. Avatar for elliiiii 128. elliiiii Lv 1 1 pt. 6,097
  9. Avatar for bkoep 129. bkoep Lv 1 1 pt. 5,900
  10. Avatar for Jiahao Xie 130. Jiahao Xie Lv 1 1 pt. 5,415

Comments