Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,532
  2. Avatar for Team China 12. Team China 1 pt. 6,542
  3. Avatar for Window Group 13. Window Group 1 pt. 5,835
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 4,684
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 2,801

  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 10,693
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 10,579
  3. Avatar for BootsMcGraw 3. BootsMcGraw Lv 1 92 pts. 10,542
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 88 pts. 10,538
  5. Avatar for jobo0502 5. jobo0502 Lv 1 84 pts. 10,524
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 80 pts. 10,514
  7. Avatar for robgee 7. robgee Lv 1 77 pts. 10,493
  8. Avatar for jausmh 8. jausmh Lv 1 73 pts. 10,486
  9. Avatar for Sandrix72 9. Sandrix72 Lv 1 70 pts. 10,470
  10. Avatar for g_b 10. g_b Lv 1 67 pts. 10,467

Comments