Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,532
  2. Avatar for Team China 12. Team China 1 pt. 6,542
  3. Avatar for Window Group 13. Window Group 1 pt. 5,835
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 4,684
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 2,801
  1. Avatar for tracybutt 101. tracybutt Lv 1 1 pt. 4,684
  2. Avatar for janice.fan 102. janice.fan Lv 1 1 pt. 3,505
  3. Avatar for Mona-Ahtesham 103. Mona-Ahtesham Lv 1 1 pt. 3,255
  4. Avatar for maria1789 104. maria1789 Lv 1 1 pt. 2,801
  5. Avatar for apetrides 105. apetrides Lv 1 1 pt. 2,801
  6. Avatar for PLM.CHY2202.BLK4.G6.AY2021.22.S2 106. PLM.CHY2202.BLK4.G6.AY2021.22.S2 Lv 1 1 pt. 2,801
  7. Avatar for PLMCHY2202LABBLK1G4AY202122S2 107. PLMCHY2202LABBLK1G4AY202122S2 Lv 1 1 pt. 2,801
  8. Avatar for U202143032 108. U202143032 Lv 1 1 pt. 2,801
  9. Avatar for jeff101 109. jeff101 Lv 1 1 pt. 2,801
  10. Avatar for Matthew Schuster 110. Matthew Schuster Lv 1 1 pt. 2,801

Comments