Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,532
  2. Avatar for Team China 12. Team China 1 pt. 6,542
  3. Avatar for Window Group 13. Window Group 1 pt. 5,835
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 4,684
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 2,801
  1. Avatar for nota 111. nota Lv 1 1 pt. 2,801
  2. Avatar for bkoep 112. bkoep Lv 1 1 pt. 2,801
  3. Avatar for rmoretti 113. rmoretti Lv 1 1 pt. 2,801
  4. Avatar for sakshamphul 114. sakshamphul Lv 1 1 pt. 2,801

Comments