Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,532
  2. Avatar for Team China 12. Team China 1 pt. 6,542
  3. Avatar for Window Group 13. Window Group 1 pt. 5,835
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 4,684
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 2,801
  1. Avatar for MicElephant 11. MicElephant Lv 1 63 pts. 10,457
  2. Avatar for grogar7 12. grogar7 Lv 1 60 pts. 10,457
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 58 pts. 10,455
  4. Avatar for Galaxie 14. Galaxie Lv 1 55 pts. 10,391
  5. Avatar for infjamc 15. infjamc Lv 1 52 pts. 10,385
  6. Avatar for frood66 16. frood66 Lv 1 50 pts. 10,370
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 47 pts. 10,354
  8. Avatar for akaaka 18. akaaka Lv 1 45 pts. 10,337
  9. Avatar for Skippysk8s 19. Skippysk8s Lv 1 42 pts. 10,330
  10. Avatar for guineapig 20. guineapig Lv 1 40 pts. 10,310

Comments