Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,532
  2. Avatar for Team China 12. Team China 1 pt. 6,542
  3. Avatar for Window Group 13. Window Group 1 pt. 5,835
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 4,684
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 2,801
  1. Avatar for drumpeter18yrs9yrs 31. drumpeter18yrs9yrs Lv 1 22 pts. 10,076
  2. Avatar for NeLikomSheet 32. NeLikomSheet Lv 1 21 pts. 9,986
  3. Avatar for heather-1 33. heather-1 Lv 1 19 pts. 9,973
  4. Avatar for fpc 34. fpc Lv 1 18 pts. 9,912
  5. Avatar for georg137 35. georg137 Lv 1 17 pts. 9,843
  6. Avatar for NPrincipi 36. NPrincipi Lv 1 16 pts. 9,798
  7. Avatar for Idiotboy 37. Idiotboy Lv 1 15 pts. 9,749
  8. Avatar for Anfinsen_slept_here 38. Anfinsen_slept_here Lv 1 14 pts. 9,716
  9. Avatar for Oransche 39. Oransche Lv 1 13 pts. 9,701
  10. Avatar for AlphaFold2 40. AlphaFold2 Lv 1 13 pts. 9,671

Comments