Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,532
  2. Avatar for Team China 12. Team China 1 pt. 6,542
  3. Avatar for Window Group 13. Window Group 1 pt. 5,835
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 4,684
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 2,801
  1. Avatar for bamh 41. bamh Lv 1 12 pts. 9,639
  2. Avatar for Crossed Sticks 42. Crossed Sticks Lv 1 11 pts. 9,589
  3. Avatar for alcor29 43. alcor29 Lv 1 10 pts. 9,523
  4. Avatar for Blipperman 44. Blipperman Lv 1 10 pts. 9,511
  5. Avatar for Zosa 45. Zosa Lv 1 9 pts. 9,443
  6. Avatar for maithra 46. maithra Lv 1 8 pts. 9,441
  7. Avatar for dizzywings 47. dizzywings Lv 1 8 pts. 9,428
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 7 pts. 9,409
  9. Avatar for Merf 49. Merf Lv 1 7 pts. 9,403
  10. Avatar for carxo 50. carxo Lv 1 6 pts. 9,354

Comments