Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,532
  2. Avatar for Team China 12. Team China 1 pt. 6,542
  3. Avatar for Window Group 13. Window Group 1 pt. 5,835
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 4,684
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 2,801
  1. Avatar for Simek 51. Simek Lv 1 6 pts. 9,354
  2. Avatar for jsfoldingaccount 52. jsfoldingaccount Lv 1 5 pts. 9,308
  3. Avatar for andrewxc 53. andrewxc Lv 1 5 pts. 9,289
  4. Avatar for equilibria 54. equilibria Lv 1 5 pts. 9,271
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 4 pts. 9,255
  6. Avatar for borattt 56. borattt Lv 1 4 pts. 9,025
  7. Avatar for zackallen 57. zackallen Lv 1 4 pts. 9,018
  8. Avatar for treyher 58. treyher Lv 1 3 pts. 8,999
  9. Avatar for thewholeblahthing 59. thewholeblahthing Lv 1 3 pts. 8,972
  10. Avatar for RyeSnake 60. RyeSnake Lv 1 3 pts. 8,886

Comments