2128: Revisiting Puzzle 134: Rice
Closed since about 4 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- March 31, 2022
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.
Sequence:
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Top groups
Comments