Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,532
  2. Avatar for Team China 12. Team China 1 pt. 6,542
  3. Avatar for Window Group 13. Window Group 1 pt. 5,835
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 4,684
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 2,801
  1. Avatar for ucad 81. ucad Lv 1 1 pt. 7,645
  2. Avatar for rinze 82. rinze Lv 1 1 pt. 7,392
  3. Avatar for Keresto 83. Keresto Lv 1 1 pt. 7,353
  4. Avatar for TheYellowKnight 84. TheYellowKnight Lv 1 1 pt. 7,273
  5. Avatar for VictoriaViki 85. VictoriaViki Lv 1 1 pt. 7,116
  6. Avatar for Mohoernchen 86. Mohoernchen Lv 1 1 pt. 7,074
  7. Avatar for furi0us 87. furi0us Lv 1 1 pt. 6,786
  8. Avatar for liebig1 88. liebig1 Lv 1 1 pt. 6,760
  9. Avatar for Lee Chun Ming 89. Lee Chun Ming Lv 1 1 pt. 6,742
  10. Avatar for ChiragMaan 90. ChiragMaan Lv 1 1 pt. 6,678

Comments