Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,694
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,579
  3. Avatar for Contenders 3. Contenders 49 pts. 10,542
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,524
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,486
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 10,330
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,671
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,354
  9. Avatar for BioCentric 9. BioCentric 3 pts. 8,999
  10. Avatar for Australia 10. Australia 2 pts. 8,830

  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 10,693
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 10,579
  3. Avatar for BootsMcGraw 3. BootsMcGraw Lv 1 92 pts. 10,542
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 88 pts. 10,538
  5. Avatar for jobo0502 5. jobo0502 Lv 1 84 pts. 10,524
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 80 pts. 10,514
  7. Avatar for robgee 7. robgee Lv 1 77 pts. 10,493
  8. Avatar for jausmh 8. jausmh Lv 1 73 pts. 10,486
  9. Avatar for Sandrix72 9. Sandrix72 Lv 1 70 pts. 10,470
  10. Avatar for g_b 10. g_b Lv 1 67 pts. 10,467

Comments