Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,694
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,579
  3. Avatar for Contenders 3. Contenders 49 pts. 10,542
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,524
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,486
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 10,330
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,671
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,354
  9. Avatar for BioCentric 9. BioCentric 3 pts. 8,999
  10. Avatar for Australia 10. Australia 2 pts. 8,830

  1. Avatar for MrZanav 91. MrZanav Lv 1 1 pt. 6,648
  2. Avatar for puzzlefolder22 92. puzzlefolder22 Lv 1 1 pt. 6,639
  3. Avatar for Hebrew Hitman 93. Hebrew Hitman Lv 1 1 pt. 6,604
  4. Avatar for Mozdzierz 94. Mozdzierz Lv 1 1 pt. 6,588
  5. Avatar for zo3xiaJonWeinberg 95. zo3xiaJonWeinberg Lv 1 1 pt. 6,542
  6. Avatar for GiletJaune 96. GiletJaune Lv 1 1 pt. 6,539
  7. Avatar for hada 98. hada Lv 1 1 pt. 6,191
  8. Avatar for jeyster 99. jeyster Lv 1 1 pt. 6,028
  9. Avatar for jflat06 100. jflat06 Lv 1 1 pt. 5,835

Comments