Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,694
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,579
  3. Avatar for Contenders 3. Contenders 49 pts. 10,542
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,524
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,486
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 10,330
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,671
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,354
  9. Avatar for BioCentric 9. BioCentric 3 pts. 8,999
  10. Avatar for Australia 10. Australia 2 pts. 8,830

  1. Avatar for tracybutt 101. tracybutt Lv 1 1 pt. 4,684
  2. Avatar for janice.fan 102. janice.fan Lv 1 1 pt. 3,505
  3. Avatar for Mona-Ahtesham 103. Mona-Ahtesham Lv 1 1 pt. 3,255
  4. Avatar for maria1789 104. maria1789 Lv 1 1 pt. 2,801
  5. Avatar for apetrides 105. apetrides Lv 1 1 pt. 2,801
  6. Avatar for U202143032 108. U202143032 Lv 1 1 pt. 2,801
  7. Avatar for jeff101 109. jeff101 Lv 1 1 pt. 2,801
  8. Avatar for Matthew Schuster 110. Matthew Schuster Lv 1 1 pt. 2,801

Comments