Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,694
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,579
  3. Avatar for Contenders 3. Contenders 49 pts. 10,542
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,524
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,486
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 10,330
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,671
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,354
  9. Avatar for BioCentric 9. BioCentric 3 pts. 8,999
  10. Avatar for Australia 10. Australia 2 pts. 8,830

  1. Avatar for MicElephant 11. MicElephant Lv 1 63 pts. 10,457
  2. Avatar for grogar7 12. grogar7 Lv 1 60 pts. 10,457
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 58 pts. 10,455
  4. Avatar for Galaxie 14. Galaxie Lv 1 55 pts. 10,391
  5. Avatar for infjamc 15. infjamc Lv 1 52 pts. 10,385
  6. Avatar for frood66 16. frood66 Lv 1 50 pts. 10,370
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 47 pts. 10,354
  8. Avatar for akaaka 18. akaaka Lv 1 45 pts. 10,337
  9. Avatar for Skippysk8s 19. Skippysk8s Lv 1 42 pts. 10,330
  10. Avatar for guineapig 20. guineapig Lv 1 40 pts. 10,310

Comments