Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,694
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,579
  3. Avatar for Contenders 3. Contenders 49 pts. 10,542
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,524
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,486
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 10,330
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,671
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,354
  9. Avatar for BioCentric 9. BioCentric 3 pts. 8,999
  10. Avatar for Australia 10. Australia 2 pts. 8,830

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 38 pts. 10,278
  2. Avatar for Punzi Baker 3 22. Punzi Baker 3 Lv 1 36 pts. 10,262
  3. Avatar for RockOn 23. RockOn Lv 1 34 pts. 10,248
  4. Avatar for blazegeek 24. blazegeek Lv 1 33 pts. 10,240
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 31 pts. 10,159
  6. Avatar for zippyc137 26. zippyc137 Lv 1 29 pts. 10,149
  7. Avatar for manu8170 27. manu8170 Lv 1 28 pts. 10,146
  8. Avatar for fiendish_ghoul 28. fiendish_ghoul Lv 1 26 pts. 10,123
  9. Avatar for ProfVince 29. ProfVince Lv 1 25 pts. 10,121
  10. Avatar for Lotus23 30. Lotus23 Lv 1 23 pts. 10,100

Comments