Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,694
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,579
  3. Avatar for Contenders 3. Contenders 49 pts. 10,542
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,524
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,486
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 10,330
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,671
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,354
  9. Avatar for BioCentric 9. BioCentric 3 pts. 8,999
  10. Avatar for Australia 10. Australia 2 pts. 8,830

  1. Avatar for bamh 41. bamh Lv 1 12 pts. 9,639
  2. Avatar for Crossed Sticks 42. Crossed Sticks Lv 1 11 pts. 9,589
  3. Avatar for alcor29 43. alcor29 Lv 1 10 pts. 9,523
  4. Avatar for Blipperman 44. Blipperman Lv 1 10 pts. 9,511
  5. Avatar for Zosa 45. Zosa Lv 1 9 pts. 9,443
  6. Avatar for maithra 46. maithra Lv 1 8 pts. 9,441
  7. Avatar for dizzywings 47. dizzywings Lv 1 8 pts. 9,428
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 7 pts. 9,409
  9. Avatar for Merf 49. Merf Lv 1 7 pts. 9,403
  10. Avatar for carxo 50. carxo Lv 1 6 pts. 9,354

Comments