Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,694
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,579
  3. Avatar for Contenders 3. Contenders 49 pts. 10,542
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,524
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,486
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 10,330
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,671
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,354
  9. Avatar for BioCentric 9. BioCentric 3 pts. 8,999
  10. Avatar for Australia 10. Australia 2 pts. 8,830

  1. Avatar for Cagdason 71. Cagdason Lv 1 1 pt. 8,532
  2. Avatar for kitsoune 72. kitsoune Lv 1 1 pt. 8,466
  3. Avatar for Larini 73. Larini Lv 1 1 pt. 8,432
  4. Avatar for Shado165 74. Shado165 Lv 1 1 pt. 8,323
  5. Avatar for nailspdx 75. nailspdx Lv 1 1 pt. 8,170
  6. Avatar for kevin everington 76. kevin everington Lv 1 1 pt. 8,124
  7. Avatar for DScott 77. DScott Lv 1 1 pt. 8,033
  8. Avatar for Beany 78. Beany Lv 1 1 pt. 7,873
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 1 pt. 7,864
  10. Avatar for antibot215 80. antibot215 Lv 1 1 pt. 7,673

Comments