Placeholder image of a protein
Icon representing a puzzle

2128: Revisiting Puzzle 134: Rice

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
March 31, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,694
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,579
  3. Avatar for Contenders 3. Contenders 49 pts. 10,542
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,524
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,486
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 10,330
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,671
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,354
  9. Avatar for BioCentric 9. BioCentric 3 pts. 8,999
  10. Avatar for Australia 10. Australia 2 pts. 8,830

  1. Avatar for diamonddays 61. diamonddays Lv 1 3 pts. 8,881
  2. Avatar for AlkiP0Ps 62. AlkiP0Ps Lv 1 3 pts. 8,830
  3. Avatar for Trajan464 63. Trajan464 Lv 1 2 pts. 8,780
  4. Avatar for Kiwegapa 64. Kiwegapa Lv 1 2 pts. 8,774
  5. Avatar for Dr.Sillem 65. Dr.Sillem Lv 1 2 pts. 8,762
  6. Avatar for Deleted player 66. Deleted player 2 pts. 8,673
  7. Avatar for kyoota 67. kyoota Lv 1 2 pts. 8,666
  8. Avatar for blocks1245 68. blocks1245 Lv 1 2 pts. 8,622
  9. Avatar for Visok 69. Visok Lv 1 2 pts. 8,618
  10. Avatar for pfirth 70. pfirth Lv 1 1 pt. 8,597

Comments